PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.3648s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 258aa    MW: 28922.5 Da    PI: 5.9086
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.3648s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM145.23.5e-4541351128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyW 83 
                             lp G+rF Pt+eelv++yL +k+eg++ el++vi+e++iy++ePwdLp+     +++++++w+fF++ + ++a+g r+nr+t+sgyW
  SapurV1A.3648s0010.1.p   4 LPIGYRFYPTEEELVSFYLDNKLEGRRQELQHVIPEIRIYDIEPWDLPQlsgeLCQGNTEQWFFFTPMQAREARGGRPNRSTASGYW 90 
                             699***************************999**************9656754455778*************************** PP

                     NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             katg+ + v+s++++++gl kt+vfy g+ap+g+kt+W m+eyr+
  SapurV1A.3648s0010.1.p  91 KATGSPRYVYSSDNQVIGLMKTMVFYMGKAPSGRKTKWKMNEYRA 135
                             *******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-483160IPR003441NAC domain
PROSITE profilePS5100547.8644161IPR003441NAC domain
PfamPF023655.3E-235134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MEELPIGYRF YPTEEELVSF YLDNKLEGRR QELQHVIPEI RIYDIEPWDL PQLSGELCQG  60
NTEQWFFFTP MQAREARGGR PNRSTASGYW KATGSPRYVY SSDNQVIGLM KTMVFYMGKA  120
PSGRKTKWKM NEYRAIGAHG LSRNATPKLR HEFSLCRVYV VSGSFRAFDR RPLGAVAGET  180
QHPLGVPHAG DAATTSAQNL MIVEMTSSPE TSYSGEDHVD NPGTAAGASW GLLDGLEPPE  240
WEWPEQLHCP GTDRFVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-36415917163NO APICAL MERISTEM PROTEIN
1ut4_B2e-36415917163NO APICAL MERISTEM PROTEIN
1ut7_A2e-36415917163NO APICAL MERISTEM PROTEIN
1ut7_B2e-36415917163NO APICAL MERISTEM PROTEIN
3swm_A2e-36415920166NAC domain-containing protein 19
3swm_B2e-36415920166NAC domain-containing protein 19
3swm_C2e-36415920166NAC domain-containing protein 19
3swm_D2e-36415920166NAC domain-containing protein 19
3swp_A2e-36415920166NAC domain-containing protein 19
3swp_B2e-36415920166NAC domain-containing protein 19
3swp_C2e-36415920166NAC domain-containing protein 19
3swp_D2e-36415920166NAC domain-containing protein 19
4dul_A2e-36415917163NAC domain-containing protein 19
4dul_B2e-36415917163NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011003860.11e-141PREDICTED: NAC domain-containing protein 90-like
SwissprotQ9FMR32e-85NAC90_ARATH; NAC domain-containing protein 90
TrEMBLB9GI041e-138B9GI04_POPTR; NAC domain-containing protein 90
STRINGPOPTR_0001s22630.11e-137(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87134123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.11e-82NAC domain containing protein 90